PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G21020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 150aa    MW: 16623.8 Da    PI: 8.3861
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G21020.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.47.8e-18957149
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                  krie + +r v fskRr+ ++ KA ELS LC+a+ av++fs  gk + y
  OB06G21020.1  9 KRIEKEDRRDVCFSKRRQSLFNKAGELSLLCNADTAVVVFSRAGKAFSY 57
                  79******************************************98777 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-25160IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.19E-22165IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.45161IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-17323IPR002100Transcription factor, MADS-box
PfamPF003193.1E-201057IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MGRKKTEIKR IEKEDRRDVC FSKRRQSLFN KAGELSLLCN ADTAVVVFSR AGKAFSYGHP  60
SVGAMAIVTP NNPSLGGGTH DSEQSSARDW MMQDYLQYCH CHIQTCKWHS HLNSSLKGMQ  120
GVTPADTHLQ ESSYGPTDEI VCANHKLPGV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656925.13e-55PREDICTED: MADS-box transcription factor 29-like
TrEMBLJ3MDK81e-112J3MDK8_ORYBR; Uncharacterized protein
STRINGOB06G21020.11e-112(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP157431316
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.13e-14AGAMOUS-like 29